Property Summary

NCBI Gene PubMed Count 7
Grant Count 8
R01 Count 8
Funding $468,556.9
PubMed Score 217.04
PubTator Score 89.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12733055 genomic region comprises three coding exons, which span 22 kb and the transcript harbors an open reading frame of 477 nucleotides encoding a protein with 158 amino acid residues, which is called cystin

AA Sequence

MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDET      1 - 70
LRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAIS     71 - 140
YDHSEEGLMASIEREYCR                                                        141 - 158
//

Text Mined References (7)

PMID Year Title
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12733055 2003 Identification of the human CYS1 gene and candidate gene analysis in Boichis disease.
11854326 2002 Cystin, a novel cilia-associated protein, is disrupted in the cpk mouse model of polycystic kidney disease.