Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.74
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.1e-04
osteosarcoma 7950 3.5e-04
pancreatic ductal adenocarcinoma liver metastasis 1962 2.4e-02
spina bifida 1074 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.187 3.5e-04
ovarian cancer 1.600 1.1e-04
pancreatic ductal adenocarcinoma liver m... -1.100 2.4e-02
spina bifida -1.205 3.3e-02

Gene RIF (5)

AA Sequence

MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY      1 - 70
SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA     71 - 140
NVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDL    141 - 210
YDDDIDDEDEEEEDADCYDDDDSGNEES                                              211 - 238
//

Text Mined References (16)

PMID Year Title