Tdark | Protein FRA10AC1 |
The protein encoded by this gene is a nuclear phosphoprotein of unknown function. The 5' UTR of this gene is part of a CpG island and contains a tandem CGG repeat region that normally consists of 8-14 repeats but can expand to over 200 repeats. The expanded allele becomes hypermethylated and is not transcribed; however, an expanded repeat region has not been associated with any disease phenotype. This gene is found within the rare FRA10A folate-sensitive fragile site. [provided by RefSeq, Mar 2010]
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 1.89591637793879E-6 |
adult high grade glioma | 2148 | 0.00131925562861853 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -2.049 | 0.000 |
adult high grade glioma | -1.100 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Pig | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREEARNRRFHLIA 1 - 70 MDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLF 71 - 140 KEYCIADLSKYKENKFGFRWRVEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRL 141 - 210 CQECSIKLNFHHRRKEIKSKKRKDKTKKDCEESSHKKSRLSSAEEASKKKDKGHSSSKKSEDSLLRNSDE 211 - 280 EESASESELWKGPLPETDEKSQEEEFDEYFQDLFL 281 - 315 //
PMID | Year | Title |
---|---|---|
26252872 | 2015 | Variations in the FRA10AC1 Fragile Site and 15q21 Are Associated with Cerebrospinal Fluid A?1-42 Level. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22365833 | 2012 | Dynamic protein-protein interaction wiring of the human spliceosome. |
21269460 | 2011 | Initial characterization of the human central proteome. |
19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. |
18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
16385451 | 2006 | A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. |
16169070 | 2005 | A human protein-protein interaction network: a resource for annotating the proteome. |
More... |