Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.95
PubTator Score 0.95

Knowledge Summary

Patent (395)

Gene RIF (9)

PMID Text
21192076 Data show that 5-HT3C, 5-HT3D, and 5-HT3E subunits are coexpressed with 5-HT3A in cell bodies of myenteric neurons, and that 5-HT3A and 5-HT3D were expressed in submucosal plexus of the human large intestine.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602613 Polymorphism in HTR3D shows differential risks for acute chemotherapy-induced vomiting after anthracycline chemotherapy.
20602613 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20356718 Observational study of gene-disease association. (HuGE Navigator)
20021265 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19794330 Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed.

AA Sequence

MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYSVATHVNISFT      1 - 70
LSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLSDVFIEESVDQTPAGLMASMS     71 - 140
IVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVA    141 - 210
TNQYEQAIFHVAIRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMND    211 - 280
LLPATSTSSHASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLL    281 - 350
HCTGQGRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE    351 - 420
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT                                        421 - 454
//

Text Mined References (16)

PMID Year Title
24603532 2014 ABCC5, a gene that influences the anterior chamber depth, is associated with primary angle closure glaucoma.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21192076 2011 Serotonin receptor diversity in the human colon: Expression of serotonin type 3 receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602613 2010 Polymorphism in HTR3D shows different risks for acute chemotherapy-induced vomiting after anthracycline chemotherapy.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20356718 2010 A coding variant of the novel serotonin receptor subunit 5-HT3E influences sustained attention in schizophrenia patients.
20021265 2010 Two naturally occurring variants of the serotonin receptor gene HTR3C are associated with nausea in pregnancy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19794330 2009 Influence of 5-HT3 receptor subunit genes HTR3A, HTR3B, HTR3C, HTR3D and HTR3E on treatment response to antipsychotics in schizophrenia.
More...