Property Summary

NCBI Gene PubMed Count 18
PubMed Score 324.06
PubTator Score 26.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Fibromyxosarcoma 3
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.047 1.4e-02
adult high grade glioma 1.400 6.5e-05
astrocytoma 2.600 2.1e-03
Astrocytoma, Pilocytic 1.900 9.2e-10
atypical teratoid / rhabdoid tumor 1.400 1.2e-03
Chronic Lymphocytic Leukemia 2.467 6.7e-05
glioblastoma 1.500 9.0e-09
group 4 medulloblastoma -1.300 1.1e-03
lung adenocarcinoma 1.017 1.9e-04
lung cancer -1.200 4.6e-02
Multiple myeloma 1.045 4.3e-02
ovarian cancer -2.400 1.3e-09
posterior fossa group A ependymoma 1.200 1.6e-08
subependymal giant cell astrocytoma 1.830 1.9e-02
ulcerative colitis 1.700 1.2e-07

Gene RIF (15)

AA Sequence

MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP      1 - 70
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVP     71 - 140
SVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSH    141 - 210
GSDSEGSLSPNPRLHPFSLPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYP    211 - 280
IPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTL    281 - 350
LQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT    351 - 420
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLL    421 - 490
ELQQHLVSAKLEGNETLKVVELDRRVNTTF                                            491 - 520
//

Text Mined References (29)

PMID Year Title