Property Summary

NCBI Gene PubMed Count 17
Grant Count 17
Funding $3,009,672.35
PubMed Score 296.89
PubTator Score 26.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (14)

PMID Text
25955804 These data suggest that the secreted luminal BBF2H7 C-terminus is involved in Hedgehog ligand-dependent cancer cell proliferation through activation of Hedgehog signaling. BBF2H7 C-terminus may be a novel target for the development of anticancer drugs.
23955342 Fbxw7 controls osteogenesis and chondrogenesis by targeting OASIS and BBF2H7, respectively, for degradation.
22495181 the BBF2H7-mediated Sec23A pathway is required for ER-to-Golgi procollagen trafficking to promote collagen synthesis
21536545 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 The human Creb3L2 can activate SPCG transcription in a heterologous system(Drosophila embryos), which suggests a general and direct role for this family of bZip transcription factors in mediating high-level secretory capacity.
20878102 We characterized a widely expressed transcript of CREB3L2 generated by an intronic polyadenylation site in intron 4 of the gene.
20471519 Fusion of the FUS and CREB3L2 genes in a supernumerary ring chromosome is associated with low-grade fibromyxoid sarcoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19212619 We characterized the promoter region of CREB3L2, showing that it is asymmetrically bidirectional
18757431 findings identify a novel CREB3L2-PPARgamma gene fusion mutation in thyroid carcinoma and reveal a thyroid signaling pathway that is regulated by intramembrane proteolysis and disrupted in cancer
More...

AA Sequence

MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSP      1 - 70
TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVP     71 - 140
SVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSH    141 - 210
GSDSEGSLSPNPRLHPFSLPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYP    211 - 280
IPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTL    281 - 350
LQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT    351 - 420
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLL    421 - 490
ELQQHLVSAKLEGNETLKVVELDRRVNTTF                                            491 - 520
//

Text Mined References (27)

PMID Year Title
25955804 2015 Promotion of Cancer Cell Proliferation by Cleaved and Secreted Luminal Domains of ER Stress Transducer BBF2H7.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23955342 2013 F-box and WD repeat domain-containing-7 (Fbxw7) protein targets endoplasmic reticulum-anchored osteogenic and chondrogenic transcriptional factors for degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705851 2012 Activation of OASIS family, ER stress transducers, is dependent on its stabilization.
22495181 2012 BBF2H7-mediated Sec23A pathway is required for endoplasmic reticulum-to-Golgi trafficking in dermal fibroblasts to promote collagen synthesis.
21536545 2011 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21041443 2010 The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity.
More...