Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 1
Funding $1,389,695.04
PubMed Score 2.64
PubTator Score 12.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q70JA7 B2RP97 Q76L22 Q86Y52
Symbols CSS3
CHSY2

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
21468578 The present study focused on the expression of chondroitin-synthesizing enzymes in colorectal cancer.
17253960 results suggest that chondroitin polymerization is achieved by multiple combinations of chondroitin synthase-1, chondroitin synthase-2, and chondroitin-polymerizing factor
12907687 The full-length open reading frame consists of 882 amino acids and encodes a typical type II membrane protein. This enzyme contains a beta 3-glycosyltransferase motif and a beta 4-glycosyltransferase motif similar to that found in CSS1.

AA Sequence

MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPRAGAQQPLPQPQSRP      1 - 70
RQEQSPPPARQDLQGPPLPEAAPGITSFRSSPWQQPPPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGG     71 - 140
AAGQRRDGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQ    141 - 210
PPNAGQPPPPLPVIALPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNS    211 - 280
SKPLYLGQTGLGNIEELGKLGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVR    281 - 350
RFGGTQCVWSYEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYR    351 - 420
TIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAENQPPRQSLSSI    421 - 490
LRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILDLLLLYKRHKGRKLTVPVRRH    491 - 560
AYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGR    561 - 630
YDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLG    631 - 700
LEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFSK    701 - 770
KTGFWRDYGYGITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCDP    771 - 840
NLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS                                841 - 882
//

Text Mined References (6)

PMID Year Title
21468578 Chondroitin synthases I, II, III and chondroitin sulfate glucuronyltransferase expression in colorectal cancer.
17253960 2007 Involvement of chondroitin sulfate synthase-3 (chondroitin synthase-2) in chondroitin polymerization through its interaction with chondroitin synthase-1 or chondroitin-polymerizing factor.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12907687 2003 Chondroitin sulfate synthase-3. Molecular cloning and characterization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.