Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.64
PubTator Score 12.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.300 2.6e-03
atypical teratoid / rhabdoid tumor -1.800 1.3e-04
ependymoma -1.600 2.4e-03
glioblastoma -1.500 1.5e-02
group 4 medulloblastoma -2.100 1.1e-03
intraductal papillary-mucinous adenoma (... -1.100 2.6e-02
intraductal papillary-mucinous carcinoma... -1.200 2.8e-02
oligodendroglioma -1.200 5.4e-03
ovarian cancer 1.900 1.9e-04
primitive neuroectodermal tumor -1.900 5.1e-03

Protein-protein Interaction (6)

Gene RIF (3)

AA Sequence

MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPRAGAQQPLPQPQSRP      1 - 70
RQEQSPPPARQDLQGPPLPEAAPGITSFRSSPWQQPPPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGG     71 - 140
AAGQRRDGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQ    141 - 210
PPNAGQPPPPLPVIALPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNS    211 - 280
SKPLYLGQTGLGNIEELGKLGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVR    281 - 350
RFGGTQCVWSYEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYR    351 - 420
TIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAENQPPRQSLSSI    421 - 490
LRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILDLLLLYKRHKGRKLTVPVRRH    491 - 560
AYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGR    561 - 630
YDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLG    631 - 700
LEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFSK    701 - 770
KTGFWRDYGYGITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCDP    771 - 840
NLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS                                841 - 882
//

Text Mined References (6)

PMID Year Title