Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.0e-06
invasive ductal carcinoma 2951 3.1e-03
mucosa-associated lymphoid tissue lymphoma 484 8.1e-03
Disease Target Count Z-score Confidence
Salmonellosis 42 4.336 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma -1.200 3.1e-03
mucosa-associated lymphoid tissue lympho... 1.059 8.1e-03
osteosarcoma -1.818 7.0e-06

Synonym

Accession Q70IA8 D3DQ22 Q0VA98 Q5TC10 Q5TC11 Q8NAZ2 Q8NF28
Symbols MOB1E
MOBKL2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNR      1 - 70
INLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVG     71 - 140
VPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREM    141 - 210
TERICH                                                                    211 - 216
//

Text Mined References (6)

PMID Year Title