Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.67
PubTator Score 10.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.100 7.2e-06
primary pancreatic ductal adenocarcinoma 1.001 2.5e-02

Gene RIF (7)

AA Sequence

MDWLMGKSKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQ      1 - 70
YSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSF     71 - 140
ESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAIMDDLTEVLCSG    141 - 210
AGGVHSGGSGDGAGSGGPGAQNHVKER                                               211 - 237
//

Text Mined References (17)

PMID Year Title