Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 3
Funding $375,885.63
PubMed Score 27.17
PubTator Score 10.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.001 0.025
group 4 medulloblastoma -1.100 0.000

Gene RIF (7)

PMID Text
25779224 The altered cell-matrix adhesion and cell motility induced by hMOB2 expression was caused by the assembly of focal adhesions.
25460043 hMOB2 interacts with RAD50, facilitating the recruitment of the MRE11-RAD50-NBS1 (MRN) DNA damage sensor complex and activated ATM to DNA damaged chromatin.
23326134 MOB2 overexpression induces apoptosis and inhibits the growth of human hepatic cancer cells
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20624913 Data indicate that human MOB2 is a negative regulator of human NDR kinases in biochemical and biological settings.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15067004 Binds to and stimulates the kinase activity of the related human serine-threonine kinases NDR1 and NDR2.

AA Sequence

MDWLMGKSKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQ      1 - 70
YSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSF     71 - 140
ESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAIMDDLTEVLCSG    141 - 210
AGGVHSGGSGDGAGSGGPGAQNHVKER                                               211 - 237
//

Text Mined References (15)

PMID Year Title
25779224 2015 Modulation of tumor cell migration, invasion and cell-matrix adhesion by human monopolar spindle-one-binder 2.
25460043 2015 Regulation of DNA damage responses and cell cycle progression by hMOB2.
23326134 2012 Growth-inhibitory effects of MOB2 on human hepatic carcinoma cell line SMMC-7721.
21269460 2011 Initial characterization of the human central proteome.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20624913 2010 Differential NDR/LATS interactions with the human MOB family reveal a negative role for human MOB2 in the regulation of human NDR kinases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...