Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $300,000
PubMed Score 32.74
PubTator Score 19.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 0.014
ependymoma -1.400 0.028
oligodendroglioma -1.300 0.024
osteosarcoma -1.538 0.000
glioblastoma -1.100 0.001
group 4 medulloblastoma -1.200 0.001
primitive neuroectodermal tumor -1.300 0.001
Breast cancer -1.300 0.000

Gene RIF (4)

PMID Text
26522469 SLC25A26 mutations cause various mitochondrial defects, including those affecting RNA stability, protein modification, mitochondrial translation, and the biosynthesis of CoQ10 and lipoic acid.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
14674884 SAMC was expressed in mitochondria of all human tissues examined. The role of SAMC is probably to exchange cytosolic SAM for mitochondrial S-adenosylhomocysteine. This is the 1st report of identification & characterization of the human SAMC & its gene.

AA Sequence

MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGSFPNAAAFFIT      1 - 70
YEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGL     71 - 140
YRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLA    141 - 210
KAGSSTADGNVLSVLHGVWRSQGLAGLFAGVFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP          211 - 274
//

Text Mined References (11)

PMID Year Title
26522469 2015 Intra-mitochondrial Methylation Deficiency Due to Mutations in SLC25A26.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14674884 2004 Identification of the human mitochondrial S-adenosylmethionine transporter: bacterial expression, reconstitution, functional characterization and tissue distribution.
More...