Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.51
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20930503 USP50 may act through a HSP90-dependent mechanism to counteract CDC25B mitotic inducing activity and prevent Wee1 degradation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVE      1 - 70
YFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFL     71 - 140
ICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFT    141 - 210
VFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTT    211 - 280
KRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA               281 - 339
//

Text Mined References (7)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
20930503 2010 A screen for deubiquitinating enzymes involved in the G?/M checkpoint identifies USP50 as a regulator of HSP90-dependent Wee1 stability.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
12838346 2003 Human and mouse proteases: a comparative genomic approach.