Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.10
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVE      1 - 70
YFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFL     71 - 140
ICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFT    141 - 210
VFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTT    211 - 280
KRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA               281 - 339
//

Text Mined References (8)

PMID Year Title