Property Summary

NCBI Gene PubMed Count 7
PubMed Score 17.32
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
spina bifida 1064 0.0482084816816309

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -1.014 0.048

Synonym

Accession Q70EL2 B2RXG0 Q5T062 Q86T44 Q86TC0 Q9BRU1
Symbols

Gene

  Ortholog (13)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
25538220 these results establish USP45 as a new regulator of XPF-ERCC1 crucial for efficient DNA repair

AA Sequence

MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLKERR      1 - 70
FYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNK     71 - 140
KVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLGNTCFFNAVMQNLAQ    141 - 210
TYTLTDLMNEIKESSTKLKIFPSSDSQLDPLVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLC    211 - 280
QKAPRFKDFQQQDSQELLHYLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFI    281 - 350
DRIFIGELTSTVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIEN    351 - 420
IHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSESRLNESPTDDS    421 - 490
EKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSAGKLLYTKETDSGDKEMAEAIS    491 - 560
ELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSYSPQNAFQTLSQSYITTSKECSIQSCLYQFTSM    561 - 630
ELLMGNNKLLCENCTKNKQKYQEETSFAEKKVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVN    631 - 700
RHVDFPLMLDLAPFCSATCKNASVGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHNTKKKNV    701 - 770
PGLKAADNESAGQWVHVSDTYLQVVPESRALSAQAYLLFYERVL                              771 - 814
//

Text Mined References (9)

PMID Year Title
25538220 2015 USP45 deubiquitylase controls ERCC1-XPF endonuclease-mediated DNA damage responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.