Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $118,711.5
PubMed Score 0.96
PubTator Score 0.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q70EK9 Q8IWJ8
Symbols

Gene

 Grant Application (1)

 GO Component (1)

Gene RIF (1)

PMID Text
27083998 USP51 is the deubiquitylating enzyme for H2AK13,15ub and regulates DNA damage response

AA Sequence

MAQVRETSLPSGSGVRWISGGGGGASPEEAVEKAGKMEEAAAGATKASSRREAEEMKLEPLQEREPAPEE      1 - 70
NLTWSSSGGDEKVLPSIPLRCHSSSSPVCPRRKPRPRPQPRARSRSQPGLSAPPPPPARPPPPPPPPPPP     71 - 140
APRPRAWRGSRRRSRPGSRPQTRRSCSGDLDGSGDPGGLGDWLLEVEFGQGPTGCSHVESFKVGKNWQKN    141 - 210
LRLIYQRFVWSGTPETRKRKAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYH    211 - 280
GVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKK    281 - 350
KRRKKSVYTVGLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYS    351 - 420
GSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCCNCIIDQIFTG    421 - 490
GLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSTVSRDDHIPGIPSLTDCLQWFTRPE    491 - 560
HLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFEHVGKQRRKINTFISFPLELDMTPFLASTKE    561 - 630
SRMKEGQPPTDCVPNENKYSLFAVINHHGTLESGHYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYL    631 - 700
LFYHKQGLEKD                                                               701 - 711
//

Text Mined References (11)

PMID Year Title
27083998 2016 USP51 deubiquitylates H2AK13,15ub and regulates DNA damage response.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
15028280 2004 Bridging expressed sequence alignments through targeted cDNA sequencing.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...