Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.30
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease -1.300 0.035
urothelial carcinoma -1.100 0.026
group 3 medulloblastoma -2.000 0.006
medulloblastoma, large-cell -1.800 0.000
acute quadriplegic myopathy 1.369 0.000
adrenocortical adenoma -1.028 0.031
adrenocortical carcinoma -2.213 0.000
non-small cell lung cancer -1.468 0.000
X-linked cerebral adrenoleukodystrophy -1.300 0.050
breast carcinoma -1.200 0.000
interstitial cystitis -1.400 0.001
atypical teratoid/rhabdoid tumor -1.200 0.000
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.700 0.000
Endometriosis -1.480 0.015
lung carcinoma -1.200 0.000
spina bifida -2.252 0.045
Breast cancer -2.700 0.000
ulcerative colitis 1.600 0.001
ovarian cancer -1.900 0.001
pituitary cancer -2.300 0.000
chronic rhinosinusitis -1.395 0.028
sarcoidosis -1.100 0.038

Gene RIF (1)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWVKFLRKPGGNLGKVYQPGSMLSLAPTKGLLNEPGQNSCFLNSAVQVLWQLDIFRRSLRVLTGHVCQG      1 - 70
DACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDAAECFENMLERIHFHIVPSRD     71 - 140
ADMCTSKSCITHQKFAMTLYEQCVCRSCGASSDPLPFTEFVRYISTTALCNEVERMLERHERFKPEMFAE    141 - 210
LLQAANTTDDYRKCPSNCGQKIKIRRVLMNCPEIVTIGLVWDSEHSDLTEAVVRNLATHLYLPGLFYRVT    211 - 280
DENAKNSELNLVGMICYTSQHYCAFAFHTKSSKWVFFDDANVKEIGTRWKDVVSKCIRCHFQPLLLFYAN    281 - 350
PDGTAVSTEDALRQVISWSHYKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSH    351 - 420
SHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQS    421 - 490
GSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDT    491 - 560
DSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSESEKRQHSPRHKPNISNKPKSSKDPSFSNWPK    561 - 630
ENPKQKGLMTIYEDEMKQEIGSRSSLESNGKGAEKNKGLVEGKVHGDNWQMQRTESGYESSDHISNGSTN    631 - 700
LDSPVIDGNGTVMDISGVKETVCFSDQITTSNLNKERGDCTSLQSQHHLEGFRKELRNLEAGYKSHEFHP    701 - 770
ESHLQIKNHLIKRSHVHEDNGKLFPSSSLQIPKDHNAREHIHQSDEQKLEKPNECKFSEWLNIENSERTG    771 - 840
LPFHVDNSASGKRVNSNEPSSLWSSHLRTVGLKPETAPLIQQQNIMDQCYFENSLSTECIIRSASRSDGC    841 - 910
QMPKLFCQNLPPPLPPKKYAITSVPQSEKSESTPDVKLTEVFKATSHLPKHSLSTASEPSLEVSTHMNDE    911 - 980
RHKETFQVRECFGNTPNCPSSSSTNDFQANSGAIDAFCQPELDSISTCPNETVSLTTYFSVDSCMTDTYR    981 - 1050
LKYHQRPKLSFPESSGFCNNSLS                                                  1051 - 1073
//

Text Mined References (12)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
23322567 2013 Identification of a candidate gene for astigmatism.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...