Property Summary

NCBI Gene PubMed Count 23
Grant Count 37
R01 Count 23
Funding $11,340,970.57
PubMed Score 30.23
PubTator Score 35.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26419705 Disruption of the RIAM/lamellipodin-integrin-talin complex markedly impairs cell migration.
26295568 The authors propose that Lpd delivers Ena/VASP proteins to growing barbed ends and increases their actin polymerase activity by tethering them to actin filaments.
26169271 These data indicate a possible role for Lpd in the actin-based movement and the cell-to-cell spread of L. monocytogenes.
24076656 this study suggests a novel mechanism in which Lpd mediates EGFR endocytosis via Mena downstream of endophilin.
24057252 The results suggest that although the RAPH1 gene was deleted or amplified in all samples, the Lpd does not seem to play a major role in tumorigenesis of mammary carcinomas.
23483482 The crystal structure of Lpd cc-RA-PH presents a molecular model of Lpd enhances actin polymerization by oligomerization via two intermolecular contact sites.
22915108 results of this study suggested that that PI(3,4)P2, Lpd, and Ena/VASP are involved in the process movement of multipolar migrating cells.
22194892 Nephrin ligation resulted in abnormal morphology of actin tails in human podocytes when Ship2, Filamin or Lamellipodin were individually knocked down.
21115820 Data show that profilin1 negatively regulates lamellipodin targeting to the leading edge; profilin1 depletion increases lamellipodin concentration at the lamellipodial tip (where it binds Ena/VASP), and this mediates the hypermotility.
19000833 Consistently, in HeLa cells, lamellipodin was required for EGF-induced proliferation.
More...

AA Sequence

MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFS      1 - 70
IYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSS     71 - 140
NRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHS    141 - 210
SITSAASSMDSLDIDKVTRPQELDLTHQGQPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDD    211 - 280
SSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIF    281 - 350
MERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLL    351 - 420
RASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDV    421 - 490
RTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSD    491 - 560
TQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNRPYTSLVPPLSPQPKIVTPYTASQPSPPLPP    561 - 630
PPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFVKYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQ    631 - 700
ILVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIP    701 - 770
APLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTL    771 - 840
PKQQSFCAKPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSSIP    841 - 910
VPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTPQRNSS    911 - 980
IKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPPPAAPPKPGKLNLSGVNLPGVLQQGCVSAKA    981 - 1050
PVLSGRGKDSVVEFPSPPSDSDFPPPPPETELPLPPIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAP   1051 - 1120
PPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSR   1121 - 1190
AEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW             1191 - 1250
//

Text Mined References (32)

PMID Year Title
26419705 2015 A RIAM/lamellipodin-talin-integrin complex forms the tip of sticky fingers that guide cell migration.
26295568 2015 Lamellipodin promotes actin assembly by clustering Ena/VASP proteins and tethering them to actin filaments.
26169271 2015 Lamellipodin Is Important for Cell-to-Cell Spread and Actin-Based Motility in Listeria monocytogenes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076656 2013 Endophilin, Lamellipodin, and Mena cooperate to regulate F-actin-dependent EGF-receptor endocytosis.
24057252 2013 Amplification and deletion of the RAPH1 gene in breast cancer patients.
23483482 2013 Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915108 2012 A phosphatidylinositol lipids system, lamellipodin, and Ena/VASP regulate dynamic morphology of multipolar migrating cells in the developing cerebral cortex.
22194892 2011 Nephrin regulates lamellipodia formation by assembling a protein complex that includes Ship2, filamin and lamellipodin.
More...