Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 6.4e-06
astrocytic glioma -1.300 2.8e-02
Astrocytoma, Pilocytic -1.300 1.2e-06
atypical teratoid / rhabdoid tumor -1.400 4.5e-06
Breast cancer -1.800 7.4e-21
breast carcinoma -1.100 2.5e-18
ependymoma -1.400 2.8e-02
glioblastoma -1.500 1.4e-05
interstitial cystitis -1.900 2.5e-04
juvenile dermatomyositis 1.031 4.0e-08
medulloblastoma, large-cell -1.700 2.3e-06
osteosarcoma 3.107 1.6e-07
permanent atrial fibrillation -1.200 2.3e-03
pituitary cancer -1.100 7.9e-04
Rheumatoid arthritis 2.100 1.5e-05
subependymal giant cell astrocytoma -1.883 1.6e-02
X-linked cerebral adrenoleukodystrophy 1.300 2.8e-02

AA Sequence

MSKVTAPGSGPPAAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSPSSARSVGSFMSRVLK      1 - 70
TLSTLSHLSSEGAAPDRGGLRSCFPPGPAAAPTPPPCPPPPASPAPPACAAEPVPGVAGLRNHGNTCFMN     71 - 140
ATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQPAGRGAQGQGEVTEQLAHLVRALWTLEYTPQHSRDF    141 - 210
KTIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDLNHSVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQE    211 - 280
LFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLR    281 - 350
EAVSMETKIPTDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLN    351 - 420
HLKFGLDYHRLSSPTQTAAKQGKMDSPTSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLL    421 - 490
QKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPIVERALKSCGPGGTAHVKLVVEW    491 - 560
DKETRDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSI    561 - 630
TLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGR    631 - 700
DPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPS    701 - 770
WSANSSVAGSTSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRS    771 - 840
VQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSIS    841 - 910
CFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDESDTRRLNSSVVDTQSKHSAQGDRLPPLS    911 - 980
GPFDNNNQIAYVDQSDSVDSSPVKEVKAPSHPGSLAKKPESTTKRSPSSKGTSEPEKSLRKGRPALASQE    981 - 1050
SSLSSTSPSSPLPVKVSLKPSRSRSKADSSSRGSGRHSSPAPAQPKKESSPKSQDSVSSPSPQKQKSASA   1051 - 1120
LTYTASSTSAKKASGPATRSPFPPGKSRTSDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGR   1121 - 1190
GAGKHVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVK   1191 - 1260
SVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSA   1261 - 1330
EKSSKKLSSSMQTSARPSQKPQ                                                   1331 - 1352
//

Text Mined References (6)

PMID Year Title