Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 8.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 7.40138269125375E-21
breast carcinoma 1614 2.46673083279573E-18
juvenile dermatomyositis 1189 4.01001466719319E-8
osteosarcoma 7933 1.62465787395272E-7
pilocytic astrocytoma 3086 1.34766699784922E-6
medulloblastoma, large-cell 6234 2.29480135378447E-6
atypical teratoid / rhabdoid tumor 4369 4.49941762643023E-6
interstitial cystitis 2299 5.38345363102082E-6
adult high grade glioma 2148 6.4384398913739E-6
glioblastoma 5572 1.3951410394301E-5
Rheumatoid Arthritis 1171 1.48545655284677E-5
pituitary cancer 1972 7.91765825469743E-4
permanent atrial fibrillation 44 0.00229862674128444
subependymal giant cell astrocytoma 2287 0.0197793723959424
X-linked cerebral adrenoleukodystrophy 115 0.0275269162337107
ependymoma 2514 0.0276421581412032
astrocytic glioma 2241 0.0283232246523269
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.000
astrocytic glioma -1.300 0.028
ependymoma -1.400 0.028
permanent atrial fibrillation -1.200 0.002
osteosarcoma 3.107 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.700 0.000
juvenile dermatomyositis 1.031 0.000
X-linked cerebral adrenoleukodystrophy 1.300 0.028
interstitial cystitis -2.100 0.000
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.133 0.020
breast carcinoma -1.100 0.000
Breast cancer -1.800 0.000
pituitary cancer -1.100 0.001

Synonym

Accession Q70CQ4 Q6AW97 Q6ZTC0 Q6ZTN2 Q9ULL7
Symbols

Gene

  Ortholog (3)

Species Source
Macaque EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid

AA Sequence

MSKVTAPGSGPPAAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSPSSARSVGSFMSRVLK      1 - 70
TLSTLSHLSSEGAAPDRGGLRSCFPPGPAAAPTPPPCPPPPASPAPPACAAEPVPGVAGLRNHGNTCFMN     71 - 140
ATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQPAGRGAQGQGEVTEQLAHLVRALWTLEYTPQHSRDF    141 - 210
KTIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDLNHSVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQE    211 - 280
LFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLR    281 - 350
EAVSMETKIPTDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLN    351 - 420
HLKFGLDYHRLSSPTQTAAKQGKMDSPTSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLL    421 - 490
QKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPIVERALKSCGPGGTAHVKLVVEW    491 - 560
DKETRDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSI    561 - 630
TLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGR    631 - 700
DPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPS    701 - 770
WSANSSVAGSTSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRS    771 - 840
VQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSIS    841 - 910
CFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDESDTRRLNSSVVDTQSKHSAQGDRLPPLS    911 - 980
GPFDNNNQIAYVDQSDSVDSSPVKEVKAPSHPGSLAKKPESTTKRSPSSKGTSEPEKSLRKGRPALASQE    981 - 1050
SSLSSTSPSSPLPVKVSLKPSRSRSKADSSSRGSGRHSSPAPAQPKKESSPKSQDSVSSPSPQKQKSASA   1051 - 1120
LTYTASSTSAKKASGPATRSPFPPGKSRTSDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGR   1121 - 1190
GAGKHVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVK   1191 - 1260
SVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSA   1261 - 1330
EKSSKKLSSSMQTSARPSQKPQ                                                   1331 - 1352
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.