Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $102,598.5
PubMed Score 15.45
PubTator Score 13.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.134 0.000
glioblastoma 1.100 0.000
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.771 0.001
tuberculosis and treatment for 6 months 1.500 0.001
spina bifida -1.227 0.043
ulcerative colitis -1.800 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q70CQ3 Q8WTU7 Q96JX4 Q9BSS3
Symbols

Gene

 Grant Application (1)

Gene RIF (5)

PMID Text
25915564 show that USP30 delays mitophagy by delaying PARK2 recruitment to the mitochondria during mitophagy
25739811 These results provide the first evidence for a fundamental role of USP30 in determining the threshold for mitochondrial cell death and suggest USP30 as a potential target for combinatorial anti-cancer therapy.
25621951 The mechanism by which parkin, an E3 ubiquitin ligase, and USP30, a mitochondrion-localized deubiquitylase, regulate mitophagy, was investigated.
24896179 reducing USP30 activity enhances mitochondrial degradation in neurons
18287522 USP30 participates in the maintenance of mitochondrial morphology, a finding that provides new insight into the cellular function of deubiquitination.

AA Sequence

MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGL      1 - 70
VNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDA     71 - 140
SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGS    141 - 210
PHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVR    211 - 280
DVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLM    281 - 350
MDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP    351 - 420
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVL    421 - 490
SSSAYLLFYERVLSRMQHQSQECKSEE                                               491 - 517
//

Text Mined References (12)

PMID Year Title
25915564 2015 Deubiquitinating enzymes regulate PARK2-mediated mitophagy.
25739811 2015 USP30 deubiquitylates mitochondrial Parkin substrates and restricts apoptotic cell death.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25527291 2015 Ubiquitin Ser65 phosphorylation affects ubiquitin structure, chain assembly and hydrolysis.
24896179 2014 The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
18287522 2008 Regulation of mitochondrial morphology by USP30, a deubiquitinating enzyme present in the mitochondrial outer membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...