Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.98
PubTator Score 1.15

Knowledge Summary

Patent

No data available

Synonym

Accession Q709F0 Q08AF0 Q658N9 Q658Y2 Q6ZND2 Q8WUT6 Q9H9R3 ACAD-11
Symbols ACAD-11

Gene

PANTHER Protein Class (2)

PDB

2WBI  

Gene RIF (7)

PMID Text
25704813 Acad11, encoding a protein involved in fatty acid oxidation, is required for efficient OXPHOS and cell survival upon glucose starvation.
21237683 ACAD11 utilizes substrates with primary carbon chain lengths between 20 and 26, with optimal activity towards C22CoA
20877624 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKPGATGESDLAEVLPQHKFDSKSLEAYLNQHLSGFGAEREATLTIAQYRAGKSNPTFYLQKGFQTYVLR      1 - 70
KKPPGSLLPKAHQIDREFKVQKALFSIGFPVPKPILYCSDTSVIGTEFYVMEHVQGRIFRDLTIPGLSPA     71 - 140
ERSAIYVATVETLAQLRSLNIQSLQLEGYGIGAGYCKRQVSTWTKQYQAAAHQDIPAMQQLSEWLMKNLP    141 - 210
DNDNEENLIHGDFRLDNIVFHPKECRVIAVLDWELSTIGHPLSDLAHFSLFYFWPRTVPMINQGSYSENS    211 - 280
GIPSMEELISIYCRCRGINSILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPLAET    281 - 350
GLQLSKRTFSTVLPQIDTTGQLFVQTRKGQEVLIKVKHFMKQHILPAEKEVTEFYVQNENSVDKWGKPLV    351 - 420
IDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEEQKKQ    421 - 490
WLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSSGAGNPKCKIAIVLGRTQNTS    491 - 560
LSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFEIHFNQVRVPATNLILGEGRGFEISQGRLGP    561 - 630
GRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGS    631 - 700
AGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELR    701 - 770
DQAKRLTAKI                                                                771 - 780
//

Text Mined References (20)

PMID Year Title
25704813 2015 Analysis of p53 transactivation domain mutants reveals Acad11 as a metabolic target important for p53 pro-survival function.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
21269460 2011 Initial characterization of the human central proteome.
21237683 2011 Identification and characterization of new long chain acyl-CoA dehydrogenases.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...