Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03

Gene RIF (1)

AA Sequence

MGCCGCSRGCGSGCGGCGSSCGGCGSGCGGCGSGRGGCGSGCGGCSSSCGGCGSRCYVPVCCCKPVCSWV      1 - 70
PACSCTSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKP     71 - 140
CCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI                                     141 - 177
//

Text Mined References (4)

PMID Year Title