Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.700 0.001

Synonym

Accession Q701N4 A9JTZ1
Symbols KRTAP5-8
KRTAP5.2

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23590728 CK7 and Cam 5.2 expression may occur in SCC. A panel including Ber-Ep4 is advisable for immunohistochemical differentiation of EPD from SCC.

AA Sequence

MGCCGCSRGCGSGCGGCGSSCGGCGSGCGGCGSGRGGCGSGCGGCSSSCGGCGSRCYVPVCCCKPVCSWV      1 - 70
PACSCTSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKP     71 - 140
CCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI                                     141 - 177
//

Text Mined References (4)

PMID Year Title
23590728 2013 Expression of CK7, Cam 5.2 and Ber-Ep4 in cutaneous squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.