Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Synonym

Accession Q701N2 A8MWN2
Symbols KRTAP5.5
KRTAP5-11

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGCCGCSGGCGSGCGGRGSGCGGCGSGCGGCGSGCGGCGSGCGGCGGCGSGCAGCGGCGSGCCVPVCCCK      1 - 70
PMCCCVPACSCSSCGKGGCGSCGGSKRGCVSCGVSKGACGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCG     71 - 140
SCGGSKGGCGSYGCSQSSCCKPCCCSSGCGSSCCQSSCCKPYCCQSSCCKPYCCQSSCCKPCSCFSGCGS    141 - 210
SCCQSSCYKPCCCQSSCCVPVCCQCKI                                               211 - 237
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15144888 2004 Identification of two novel clusters of ultrahigh-sulfur keratin-associated protein genes on human chromosome 11.