Property Summary

NCBI Gene PubMed Count 20
PubMed Score 48.30
PubTator Score 43.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.300 3.5e-02
adult high grade glioma -1.200 2.6e-03
Astrocytoma, Pilocytic -1.100 7.0e-04
atypical teratoid / rhabdoid tumor -1.500 3.6e-04
glioblastoma -1.500 1.3e-06
lung cancer 1.500 3.2e-02
medulloblastoma, large-cell -1.800 4.9e-06
osteosarcoma 1.411 1.2e-03
ovarian cancer -1.500 3.8e-06
pituitary cancer 1.200 5.4e-04
Polycystic ovary syndrome 1.155 3.2e-02

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ      1 - 70
K//

Text Mined References (21)

PMID Year Title