Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.07
PubTator Score 468.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.314 1.9e-04
adult high grade glioma -1.400 9.6e-04
astrocytic glioma -1.300 3.0e-02
atypical teratoid / rhabdoid tumor -1.500 3.0e-03
Breast cancer 2.400 3.0e-02
gastric cancer 1.100 1.5e-03
glioblastoma -1.400 1.6e-04
medulloblastoma -1.100 9.0e-03
medulloblastoma, large-cell -2.100 7.6e-06
non-small cell lung cancer 1.170 2.7e-12
ovarian cancer -1.300 4.5e-04
pancreatic ductal adenocarcinoma liver m... -1.396 6.9e-03
spina bifida -1.241 1.7e-02

Gene RIF (2)

AA Sequence

MANINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSEERSHKSY      1 - 70
RPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIASLLFAVHPIHTEAVTGV     71 - 140
VGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGITVVGICCVYEVFIAQGYT    141 - 210
LPLLCTTAGQFLRGKGSIPFSMLQTLVKLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQ    211 - 280
LTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSIRYSGDSSKTVLM    281 - 350
ALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK    351 - 420
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTY    421 - 490
KNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANESRLEEADQLYRQAISMRP    491 - 560
DFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKKNFNRALELNPK    561 - 630
HKLALFNSAIVMQESGEVKLRPEARKRLLSYINEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQA    631 - 700
DFRSALFNLALLYSQTAKELKALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPS    701 - 770
NVQGKHNLCVVYFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKISSVEGK    771 - 840
KIPTESVKEIRGESRQTQIVKTSDNKSQSKSNKQLGKNGDEETPHKTTKDIKEIEKKRVAALKRLEEIER    841 - 910
ILNGE                                                                     911 - 915
//

Text Mined References (14)

PMID Year Title