Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.88
PubTator Score 19.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.80465012544375E-11
ovarian cancer 8492 1.48875778677693E-9
pancreatic cancer 2300 1.93789643553275E-6
osteosarcoma 7933 1.13931681753586E-5
Breast cancer 3099 3.56949703600661E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 6.05118731309451E-5
nasopharyngeal carcinoma 1056 4.20035022275912E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00305379922296806
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00426630738596396
primary pancreatic ductal adenocarcinoma 1271 0.010514930850319
invasive ductal carcinoma 2950 0.027255183400026
Disease Target Count Z-score Confidence
Neutral lipid storage disease 14 4.251 2.1

Expression

Synonym

Accession Q6ZWT7 A9EDR2 Q8NCE7 Q96KY4 LPLAT 2
Symbols LPAAT
LPEAT
OACT2
LPCAT4
LPLAT 2

Gene

PANTHER Protein Class (2)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG

AA Sequence

MATTSTTGSTLLQPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALF      1 - 70
CFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYIFDYGQYSADFSGPMMIITQK     71 - 140
ITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHIT    141 - 210
QSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYIS    211 - 280
LLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLK    281 - 350
RVCYERTSFSPTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWI    351 - 420
VTQVAISYTVVPFVLLSIKPSLTFYSSWYYCLHILGILVLLLLPVKKTQRRKNTHENIQLSQSKKFDEGE    421 - 490
NSLGQNSFSTTNNVCNQNQEIASRHSSLKQ                                            491 - 520
//

Text Mined References (10)

PMID Year Title
18772128 2008 Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils.
17890783 2007 LPT1 encodes a membrane-bound O-acyltransferase involved in the acylation of lysophospholipids in the yeast Saccharomyces cerevisiae.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.