Property Summary

NCBI Gene PubMed Count 48
PubMed Score 534.69
PubTator Score 807.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.400 2.3e-06
chronic rhinosinusitis -1.001 2.2e-02
cystic fibrosis 1.100 1.3e-03
group 3 medulloblastoma -1.400 4.2e-03
medulloblastoma, large-cell -1.500 1.1e-04
non-small cell lung cancer -1.496 1.9e-16
osteosarcoma -1.399 3.9e-03
ovarian cancer -1.900 2.5e-05
pancreatic ductal adenocarcinoma liver m... -1.874 3.6e-03
tuberculosis 1.200 3.5e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (40)

AA Sequence

MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDG      1 - 70
REFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTG     71 - 140
NKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIG    141 - 210
AQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANE    211 - 280
DCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPE    281 - 350
VQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV    351 - 420
IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWI    421 - 490
ESNQKREELGLEGQLILRPSNGIWIKLKRRNADER                                       491 - 525
//

Text Mined References (49)

PMID Year Title