Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZWC4
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MCWGKHWPRPEGRNLACSKGSPGWRTAGQGSGSYGAATLGKGTEQRGVGALRRGLLSFTCFCLSNWTSGA      1 - 70
GFSEMGRSRFEEGRLGYSSDVLSARPTMSPTEMLRSRALNLGAATVLRRHRAPQGTSSYQEGRRAHEATS     71 - 140
AESDDDNGVQVLASLAVSCAQHSRHKDPVGTQLQQACAQVPTSRAPLWPCPSHRLMHSTDGPLDPEPLST    141 - 210
LLPAA                                                                     211 - 215
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.