Property Summary

NCBI Gene PubMed Count 26
Grant Count 34
R01 Count 16
Funding $2,684,068.34
PubMed Score 42.12
PubTator Score 25.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis 1.100 0.002
group 3 medulloblastoma 1.700 0.031
adrenocortical carcinoma 1.208 0.000
non-small cell lung cancer 1.056 0.000
subependymal giant cell astrocytoma -1.910 0.035
invasive ductal carcinoma 1.100 0.000
ovarian cancer 1.400 0.000

Gene RIF (16)

PMID Text
25631048 PPM1B can dephosphorylate the Pax2 activation domain and displace the adaptor protein PTIP, thus inhibiting H3K4 methylation and gene activation.
25512557 uncovered a nuclease, Artemis, as a PTIP-binding protein
24486544 PITX2 and PTIP co-occupy the promoter of the PITX2's transcriptional target.
22736030 Polyglutamine expansion AR sequesters PTIP to attenuate DNA repair and increase genomic instability.
22064073 a new clue to identify the role of PTIP in DNA damage pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20088963 PTIP promotes double-strand break repair through a direct role in homologous recombination.
19583951 PTIP controls expression of PPARgamma and C/EBPalpha, the two principal adipogenic transcription factors, and is therefore required for adipogenesis.
19414588 PTIP regulates 53BP1-dependent signaling pathway following DNA damage
19124460 subset of PTIP.PA1 complex is recruited to DNA damage sites via the RNF8-dependent pathway and is required for cell survival in response to DNA damage.
More...

AA Sequence

MSDQAPKVPEEMFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPV      1 - 70
VKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFYGGDCQLTLNKKCTHLI     71 - 140
VPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFYHPRLIIYEEEEEEEEEEEEVENEEQDSQN    141 - 210
EGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRR    211 - 280
LPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQM    281 - 350
NRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQ    351 - 420
PQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQP    421 - 490
FQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQT    491 - 560
SQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADYPEQMSDKQLLATWK    561 - 630
RIIQAHGGTVDPTFTSRCTHLLCESQVSSAYAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFP    631 - 700
PGGKPCSQHIISVTGFVDSDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPTGLKYEKAKEWRIPCVNAQ    701 - 770
WLGDILLGNFEALRQIQYSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVA    771 - 840
NVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTR    841 - 910
TVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYI    911 - 980
TPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCREYFARGIDVHNAE    981 - 1050
FVLTGVLTQTLDYESYKFN                                                      1051 - 1069
//

Text Mined References (33)

PMID Year Title
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25512557 2014 PTIP associates with Artemis to dictate DNA repair pathway choice.
25416956 2014 A proteome-scale map of the human interactome network.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24486544 2014 PITX2 associates with PTIP-containing histone H3 lysine 4 methyltransferase complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22736030 2012 A polyglutamine expansion disease protein sequesters PTIP to attenuate DNA repair and increase genomic instability.
22064073 2011 Structural basis of ?H2AX recognition by human PTIP BRCT5-BRCT6 domains in the DNA damage response pathway.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...