Property Summary

NCBI Gene PubMed Count 28
PubMed Score 44.68
PubTator Score 25.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Disease Target Count
Alzheimer's disease 658
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Kabuki syndrome 27 3.248 1.6
Ectropion 38 3.006 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.208 1.1e-04
group 3 medulloblastoma 1.700 3.1e-02
invasive ductal carcinoma 1.100 2.8e-04
malignant mesothelioma 1.300 4.8e-07
non-small cell lung cancer 1.056 6.9e-15
ovarian cancer 1.400 1.5e-05
psoriasis 1.100 2.3e-03
subependymal giant cell astrocytoma -1.910 3.5e-02

Protein-protein Interaction (1)

Gene RIF (17)

AA Sequence

MSDQAPKVPEEMFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPV      1 - 70
VKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWALVTFYGGDCQLTLNKKCTHLI     71 - 140
VPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAFYHPRLIIYEEEEEEEEEEEEVENEEQDSQN    141 - 210
EGSTDEKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRR    211 - 280
LPQGKEPGLINLCANVPPVPGNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQM    281 - 350
NRPSNVAHILQTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQ    351 - 420
PQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQLHRPQQQLQP    421 - 490
FQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQMQSQTAPHLSQT    491 - 560
SQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEIPEEGFLLGCVFAIADYPEQMSDKQLLATWK    561 - 630
RIIQAHGGTVDPTFTSRCTHLLCESQVSSAYAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFP    631 - 700
PGGKPCSQHIISVTGFVDSDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPTGLKYEKAKEWRIPCVNAQ    701 - 770
WLGDILLGNFEALRQIQYSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVA    771 - 840
NVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTR    841 - 910
TVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYI    911 - 980
TPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCREYFARGIDVHNAE    981 - 1050
FVLTGVLTQTLDYESYKFN                                                      1051 - 1069
//

Text Mined References (36)

PMID Year Title