Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


AA Sequence

GVSDHKAEVDKSTQVDIDKMLSVCTAPLVPPLSPQYK                                     281 - 317

Text Mined References (4)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.