Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.04
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZVZ8 B6ZDL7 ASB-18
Symbols ASB-18

Gene

AA Sequence

MSNSDYLPDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGD      1 - 70
LDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKRELTTPLCIAAAHGHTACVRHLL     71 - 140
GRGADPDASPGGRGALHEACLGGHTACVRLLLQHRADPDLLSAEGLAPLHLCRTAASLGCAQALLEHGAS    141 - 210
VQRVGGTGRDTPLHVAAQRGLDEHARLYLGRGAHVDARNGRGETALSAACGAARRPDEHGRCLRLCALLL    211 - 280
RRGAEADARDEDERSPLHKACGHASHSLARLLLRHGADAGALDYGGASPLGRVLQTASCALQASPQRTVQ    281 - 350
ALLNHGSPTVWPDAFPKVLKTCASVPAVIEVLFNSYPQLCLSESWKEVIPEEVFQMHKPFYQSLFALALT    351 - 420
PRCLQHLCRCALRRLFGKRCFDLIPLLPLPKPLQNYLLLEPQGVLH                            421 - 466
//

Text Mined References (7)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12076535 2002 The SOCS box: a tale of destruction and degradation.