Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 2.41927804766631E-13
osteosarcoma 7933 4.57918914364072E-6
pituitary cancer 1972 1.98282564199487E-4
group 3 medulloblastoma 2254 7.91044849311858E-4
oligodendroglioma 2849 0.00473099381645389
atypical teratoid / rhabdoid tumor 4369 0.00483733296724612
astrocytic glioma 2241 0.00644922246423719
medulloblastoma, large-cell 6234 0.00676712739016263
glioblastoma 5572 0.0356089161886389

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.006
ependymoma -1.600 0.000
oligodendroglioma -1.500 0.005
osteosarcoma -3.423 0.000
atypical teratoid / rhabdoid tumor -1.300 0.005
glioblastoma -1.200 0.036
medulloblastoma, large-cell -1.200 0.007
group 3 medulloblastoma 2.200 0.001
pituitary cancer 1.700 0.000

Synonym

Accession Q6ZVX9 Q147T6
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
23161870 The results suggest that PAQR6 and PAQR9 (mPRdelta and mPRepsilon) function as mPRs coupled to G proteins and are potential intermediaries of nonclassical antiapoptotic actions of neurosteroids in the central nervous system.
18603275 PAQR9 is a previously uncharacterized PAQR which is also capable of responding to progesterone.

AA Sequence

MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTA      1 - 70
QECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAH     71 - 140
VFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYR    141 - 210
ALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRR    211 - 280
YFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTV    281 - 350
GYMLLLVVCLGLVIRKFLNSSEFCSKK                                               351 - 377
//

Text Mined References (7)

PMID Year Title
23161870 2013 Characterization, neurosteroid binding and brain distribution of human membrane progesterone receptors ? and {epsilon} (mPR? and mPR{epsilon}) and mPR? involvement in neurosteroid inhibition of apoptosis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
18603275 2008 Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in yeast confirms their ability to function as membrane progesterone receptors.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.