Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 6.4e-03
atypical teratoid / rhabdoid tumor -1.300 4.8e-03
ependymoma -1.500 1.0e-02
glioblastoma -1.200 3.6e-02
group 3 medulloblastoma 2.200 7.9e-04
medulloblastoma, large-cell -1.200 6.8e-03
oligodendroglioma -1.500 4.7e-03
osteosarcoma -3.423 4.6e-06
pituitary cancer 1.700 2.0e-04

Gene RIF (2)

AA Sequence

MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTA      1 - 70
QECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAH     71 - 140
VFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYR    141 - 210
ALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRR    211 - 280
YFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTV    281 - 350
GYMLLLVVCLGLVIRKFLNSSEFCSKK                                               351 - 377
//

Text Mined References (8)

PMID Year Title