Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.57
PubTator Score 0.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.006
ependymoma -1.600 0.000
oligodendroglioma -1.500 0.005
osteosarcoma -3.423 0.000
atypical teratoid / rhabdoid tumor -1.300 0.005
glioblastoma -1.200 0.036
medulloblastoma, large-cell -1.200 0.007
group 3 medulloblastoma 2.200 0.001
pituitary cancer 1.700 0.000

Gene RIF (2)

PMID Text
23161870 The results suggest that PAQR6 and PAQR9 (mPRdelta and mPRepsilon) function as mPRs coupled to G proteins and are potential intermediaries of nonclassical antiapoptotic actions of neurosteroids in the central nervous system.
18603275 PAQR9 is a previously uncharacterized PAQR which is also capable of responding to progesterone.

AA Sequence

MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTA      1 - 70
QECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAH     71 - 140
VFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYR    141 - 210
ALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRR    211 - 280
YFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTV    281 - 350
GYMLLLVVCLGLVIRKFLNSSEFCSKK                                               351 - 377
//

Text Mined References (7)

PMID Year Title
23161870 2013 Characterization, neurosteroid binding and brain distribution of human membrane progesterone receptors ? and {epsilon} (mPR? and mPR{epsilon}) and mPR? involvement in neurosteroid inhibition of apoptosis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
18603275 2008 Heterologous expression of human mPRalpha, mPRbeta and mPRgamma in yeast confirms their ability to function as membrane progesterone receptors.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.