Property Summary

NCBI Gene PubMed Count 5
PubMed Score 21.64
PubTator Score 7.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.9e-56
Disease Target Count Z-score Confidence
Progressive relapsing multiple sclerosis 19 4.303 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 5.9e-56

Synonym

Accession Q6ZVX7 Q6NVV5
Symbols FBXO50
NCCRP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHAR      1 - 70
QLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWY     71 - 140
IRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIA    141 - 210
QHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE         211 - 275
//

Text Mined References (8)

PMID Year Title