Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.73
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (3)

PMID Text
26480299 Rare Il17REL Variants are associated with Familial and Sporadic Inflammatory Bowel Disease.
20228798 We performed a genome-wide association analysis of ulcerative colitis and discovered new associations in il17rel
20228798 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRSVLEALTSSTAMQCVPSDGCAMLLRVRASITLHERLRGLEACAMSLDTQETQCQSVWVARASHRQQG      1 - 70
GQQLQVHFGCFAVSVAQHLYVTLRTIPHFCGVQLDQRHLVEAGKLSYWVDRRRKAILVQVPRASGSPDYY     71 - 140
LRLCLKRFTCEDAGAPVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWD    141 - 210
TVYYHPESQTLSWEPACPVSGHVSLCWRPGPGAGCRKLQQSSQLVHRRVQYPLVDTQPQLCLKFSTSWGS    211 - 280
WVRCPFEQRRFPTPPTSRCTCVTGGSHSSLPANAHSRPARSLQPQVTWQPPLLLPS                  281 - 336
//

Text Mined References (6)

PMID Year Title
26480299 2016 Whole-exome Sequence Analysis Implicates Rare Il17REL Variants in Familial and Sporadic Inflammatory Bowel Disease.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20228798 2010 Genome-wide association study for ulcerative colitis identifies risk loci at 7q22 and 22q13 (IL17REL).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10591208 1999 The DNA sequence of human chromosome 22.