Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.26
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Colitis, Ulcerative 59 0.0 0.0
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 2.4

Expression

Gene RIF (3)

AA Sequence

MSRSVLEALTSSTAMQCVPSDGCAMLLRVRASITLHERLRGLEACAMSLDTQETQCQSVWVARASHRQQG      1 - 70
GQQLQVHFGCFAVSVAQHLYVTLRTIPHFCGVQLDQRHLVEAGKLSYWVDRRRKAILVQVPRASGSPDYY     71 - 140
LRLCLKRFTCEDAGAPVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWD    141 - 210
TVYYHPESQTLSWEPACPVSGHVSLCWRPGPGAGCRKLQQSSQLVHRRVQYPLVDTQPQLCLKFSTSWGS    211 - 280
WVRCPFEQRRFPTPPTSRCTCVTGGSHSSLPANAHSRPARSLQPQVTWQPPLLLPS                  281 - 336
//

Text Mined References (6)

PMID Year Title