Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.53
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.2e-07
osteosarcoma 7950 1.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Fundus dystrophy 83 3.77 1.9
Cone dystrophy 71 3.457 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.256 1.6e-06
ovarian cancer 1.200 1.2e-07

AA Sequence

MDHSCTRFIHRRGPPTRTRAGFKRGKRPRIQQRPRARVSGTIPASRLHPAPASQPGPCPAPGHCPVGPAH      1 - 70
ERPMGSSQEEGLRCQPSQPDHDADGHCGPDLEGAERASATPGPPGLLNSHRPADSDDTNAAGPSAALLEG     71 - 140
LLLGGGKPSPHSTRPGPFFYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGE    141 - 210
QLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLR    211 - 280
MEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHK    281 - 350
TPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQ    351 - 420
FMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLG    421 - 490
YFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPLLSQR    491 - 560
RFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKSSGPPMPHAPDQPGARRPAPPPLVPQRPRPPGPDLD    561 - 630
SAHDGEPQAPGTEQSGTGNRHPAQEPSPGTAKEEREEPENARP                               631 - 673
//

Text Mined References (10)

PMID Year Title