Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZVS7 A4D1Y1 C9W8M8
Symbols THEG6
FAM183B

Gene

 Compartment GO Term (2)

AA Sequence

MAGHPKERVVTDEVHQNQILRELYLKELRTQKLHTQYHVNPLRKVHRITRKPMSWHDNLEEPADARFLNL      1 - 70
IHHAAQGPTKKYPEAQTENQEIGWDSEALVDPERRDHRMNHFRVYSDITLYKAKMWSLGEDDRHK          71 - 135
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.