Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZVS7 A4D1Y1 C9W8M8
Symbols THEG6
FAM183B

Gene

 Compartment GO Term (2)

AA Sequence

MAGHPKERVVTDEVHQNQILRELYLKELRTQKLHTQYHVNPLRKVHRITRKPMSWHDNLEEPADARFLNL      1 - 70
IHHAAQGPTKKYPEAQTENQEIGWDSEALVDPERRDHRMNHFRVYSDITLYKAKMWSLGEDDRHK          71 - 135
//

Text Mined References (5)

PMID Year Title