Property Summary

NCBI Gene PubMed Count 80
PubMed Score 146.90
PubTator Score 97.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (66)

AA Sequence

MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGR      1 - 70
GGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGS     71 - 140
GLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMAL    141 - 210
GANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAY    211 - 280
IGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEG    281 - 350
LPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFV    351 - 420
LWLCIQ                                                                    421 - 426
//

Text Mined References (80)

PMID Year Title