Property Summary

NCBI Gene PubMed Count 46
PubMed Score 0.49
PubTator Score 170.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteoporosis 363 3.149 1.6

Synonym

Accession Q6ZVN7
Symbols ECD
DSS1
SHFD1
SHFM1
SHSF1
Shfdg1
C7orf76

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (21)

AA Sequence

MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINLEMPNSRATTE      1 - 70
LAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYNLAPAERTC                 71 - 128
//

Text Mined References (46)

PMID Year Title