Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Osteoporosis 257 3.155 1.6

Synonym

Accession Q6ZVN7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINLEMPNSRATTE      1 - 70
LAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYNLAPAERTC                 71 - 128
//

Text Mined References (6)

PMID Year Title
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.