Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.43
PubTator Score 2.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.020 0.000
posterior fossa group A ependymoma -1.300 0.000
glioblastoma -1.400 0.000
group 4 medulloblastoma -1.700 0.000
medulloblastoma, large-cell -1.900 0.000
pediatric high grade glioma -1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.011
Breast cancer -1.600 0.000

Synonym

Accession Q6ZVM7 B7Z2L7 B7Z7F4 Q86V61 Q8TDE7 Q96M88
Symbols

Gene

Gene RIF (2)

PMID Text
20167577 Two possible dementia susceptibility genes including ATPAF2 and TOM1L2 near SREBF1 locus were identified.
20167577 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLA      1 - 70
LTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHI     71 - 140
YEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSV    141 - 210
TGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVS    211 - 280
NEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAP    281 - 350
PSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNR    351 - 420
KQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPMEAPAPASN    421 - 490
PSGRKKPERSEDALFAL                                                         491 - 507
//

Text Mined References (24)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...