Property Summary

NCBI Gene PubMed Count 21
PubMed Score 2.60
PubTator Score 2.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Thanatophoric dysplasia 7 4.059 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-05
Breast cancer -1.600 1.5e-05
ependymoma -1.200 3.7e-17
glioblastoma -1.400 8.1e-10
group 3 medulloblastoma -1.200 3.9e-04
medulloblastoma, large-cell -1.900 5.7e-06
non primary Sjogren syndrome sicca 1.100 1.1e-02
osteosarcoma 2.020 8.3e-09

Protein-protein Interaction (3)

Gene RIF (3)

AA Sequence

MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLA      1 - 70
LTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHI     71 - 140
YEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSV    141 - 210
TGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVS    211 - 280
NEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAP    281 - 350
PSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNR    351 - 420
KQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPMEAPAPASN    421 - 490
PSGRKKPERSEDALFAL                                                         491 - 507
//

Text Mined References (25)

PMID Year Title