Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.72
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.500 1.7e-03
astrocytic glioma -1.900 3.9e-03
Astrocytoma, Pilocytic -1.200 1.2e-04
atypical teratoid / rhabdoid tumor -2.300 6.9e-07
cystic fibrosis 1.768 4.9e-05
ependymoma -1.700 2.8e-04
glioblastoma -1.200 2.0e-05
group 3 medulloblastoma -1.900 4.6e-02
malignant mesothelioma -1.500 1.2e-04
medulloblastoma, large-cell -2.300 1.3e-06
oligodendroglioma -1.500 1.9e-02
osteosarcoma 1.911 3.3e-05
ovarian cancer 1.800 9.6e-11
Pick disease -1.100 4.2e-02
pituitary cancer 2.300 2.3e-07
primitive neuroectodermal tumor -1.400 4.5e-03
pulmonary arterial hypertension -1.500 4.3e-02
subependymal giant cell astrocytoma -2.774 2.0e-02

Synonym

Accession Q6ZVL6 B0QYU0
Symbols G2
C11orf41
C11orf69

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDHTASQNAQDLIGIPHLGVSGSSTKWHSELSPTEGPHSAGSSTPGFLSPMAELSHPSPPPPALGSLLQL      1 - 70
PDGSPSWSMLEVASGPASTQQIKAGVPGRVHNGVSLPTFKNTETATHEAEPPLFQTAESGAIEMTSRKLA     71 - 140
SATANDSANPLHLSAAPENSRGPALSAEHTSSLVPSLHITTLGQEQAILSGAVPASPSTGTADFPSILTF    141 - 210
LQPTENHASPSPVPEMPTLPAEGSDGSPPATRDLLLSSKVPNLLSTSWTFPRWKKDSVTAILGKNEEANV    211 - 280
TIPLQAFPRKEVLSLHTVNGFVSDFSTGSVSSPIITAPRTNPLPSGPPLPSILSIQATQTVFPSLGFSST    281 - 350
KPEAYAAAVDHSGLPASASKQVRASPSSMDVYDSLTIGDMKKPATTDVFWSSLSAETGSLSTESIISGLQ    351 - 420
QQTNYDLNGHTISTTSWETHLAPTAPPNGLTSAADAIKSQDFKDTAGHSVTAEGFSIQDLVLGTSIEQPV    421 - 490
QQSDMTMVGSHIDLWPTSNNNHSRDFQTAEVAYYSPTTRHSVSHPQLQLPNQPAHPLLLTSPGPTSTGSL    491 - 560
QEMLSDGTDTGSEISSDINSSPERNASTPFQNILGYHSAAESSISTSVFPRTSSRVLRASQHPKKWTADT    561 - 630
VSSKVQPTAAAAVTLFLRKSSPPALSAALVAKGTSSSPLAVASGPAKSSSMTTLAKNVTNKAASGPKRTP    631 - 700
GAVHTAFPFTPTYMYARTGHTTSTHTAMQGNMDTASGLLSTTYLPRKPQAMHTGLPNPTNLEMPRASTPR    701 - 770
PLTVTAALTSITASVKATRLPPLRAENTDAVLPAASAAVVTTGKMASNLECQMSSKLLVKTVLFLTQRRV    771 - 840
QISESLKFSIAKGLTQALRKAFHQNDVSAHVDILEYSHNVTVGYYATKGKLVYLPAVVIEMLGVYGVSNV    841 - 910
TADLKQHTPHLQSVAVLASPWNPQPAGYFQLKTVLQFVSQADNIQSCKFAQTMEQRLQKAFQDAERKVLN    911 - 980
TKSNLTIQIVSTSNASQAVTLVYVVGNQSTFLNGTVASSLLSQLSAELVGFYLTYPPLTIAEPLEYPNLD    981 - 1050
ISETTRDYWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMMSQQQGRRFKRATTLGSYTVQMVKMQRV   1051 - 1120
PGPKDPAELTYYTLYNGKPLLGTAAAKILSTIDSQRMALTLHHVVLLQADPVVKNPPNNLWIIAAVLAPI   1121 - 1190
AVVTVIIIIITAVLCRKNKNDFKPDTMINLPQRAKPVQGFDYAKQHLGQQGADEEVIPVTQETVVLPLPI   1191 - 1260
RDAPQERDVAQDGSTIKTAKSTETRKSRSPSENGSVISNESGKPSSGRRSPQNVMAQQKVTKEEARKRNV   1261 - 1330
PASDEEEGAVLFDNSSKVAAEPFDTSSGSVQLIAIKPTALPMVPPTSDRSQESSAVLNGEVNKALKQKSD   1331 - 1400
IEHYRNKLRLKAKRKGYYDFPAVETSKGLTERKKMYEKAPKEMEHVLDPDSELCAPFTESKNRQQMKNSV   1401 - 1470
YRSRQSLNSPSPGETEMDLLVTRERPRRGIRNSGYDTEPEIIEETNIDRVPEPRGYSRSRQVKGHSETST   1471 - 1540
LSSQPSIDEVRQQMHMLLEEAFSLASAGHAGQSRHQEAYGSAQHLPYSEVVTSAPGTMTRPRAGVQWVPT   1541 - 1610
YRPEMYQYSLPRPAYRFSQLPEMVMGSPPPPVPPRTGPVAVASLRRSTSDIGSKTRMAESTGPEPAQLHD   1611 - 1680
SASFTQMSRGPVSVTQLDQSALNYSGNTVPAVFAIPAANRPGFTGYFIPTPPSSYRNQAWMSYAGENELP   1681 - 1750
SQWADSVPLPGYIEAYPRSRYPQSSPSRLPRQYSQPANLHPSLEQAPAPSTAASQQSLAENDPSDAPLTN   1751 - 1820
ISTAALVKAIREEVAKLAKKQTDMFEFQV                                            1821 - 1849
//

Text Mined References (10)

PMID Year Title