Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.20
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.2e-04
psoriasis 6694 5.8e-04
malignant mesothelioma 3232 1.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.100 1.3e-03
medulloblastoma, large-cell -1.500 3.2e-04
psoriasis 1.300 5.8e-04

Gene RIF (1)

AA Sequence

MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGS      1 - 70
WYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESL     71 - 140
QAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVG    141 - 210
MPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRS    211 - 280
PGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR                               281 - 323
//

Text Mined References (12)

PMID Year Title