Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.9e-07
diabetes mellitus 1728 1.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.8e-03
psoriasis -1.700 2.9e-07

AA Sequence

MALNNFLFAQCACYFLAFLFSFVVVVPLSENGHDFRGRCLLFTEGMWLSANLTVQERERFTVQEWGPPAA      1 - 70
CRFSLLASLLSLLLAAAHAWRTLFFLCKGHEGSFFSAFLNLLVSAFVVFLVFIASTIVSVGFTMWCDTIT     71 - 140
EKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQFGLWASWLAWLAITTLAFLKVYHNYRQEDLLDSLIH    141 - 210
EKELLLARPSPRTSFQEEKSAVI                                                   211 - 233
//

Text Mined References (2)

PMID Year Title