Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.35
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.6e-02
ependymoma -1.600 5.1e-07
gastric cancer 1.200 2.7e-03
glioblastoma -1.100 6.9e-04
interstitial cystitis 1.100 6.8e-03
intraductal papillary-mucinous adenoma (... 1.300 2.0e-02
intraductal papillary-mucinous carcinoma... 1.500 4.4e-02
medulloblastoma, large-cell 1.600 2.2e-02
osteosarcoma -1.863 2.6e-03
pediatric high grade glioma -1.200 1.6e-02
pituitary cancer -1.100 2.5e-05
tuberculosis -1.400 1.4e-07

Gene RIF (1)

AA Sequence

MGTVPDPLRSAKTSLIAASGKEDDLGEPQAASPRHRPALLCKNANGFSGAPAEPDLSPRAAAEALMQVCE      1 - 70
HETTQPDMSSPGVFNEVQKAPATFNSPGNPQLPGSSQPAASAPSSAAGRDLIHTPLTMPANQHTCQSIPG     71 - 140
DQPNAITSSMPEDSLMRSQRTSNREQPEKPSCPVGGVLSSSKDQVSCEFPSPETIQGTVQTPVTAARVVS    141 - 210
HSSSPVGGPEGERQGAICDSEMRSCKPLTRESGCSENKQPSVTASGPQGTTSVTPQPTPLTSEPSACPPG    211 - 280
PEKVPLPAQRQMSRFKEASTMTNQAESEIKEVPSRAWQDAEVQAVASVESRSVSTSPSILTAFLKESRAP    281 - 350
EHFEQEQLRVICHSSGSHTLELSDSTLAPQESSQCPGIMPQVHIQAAAAESTAFQRENKLASLPGGVLKT    351 - 420
SSINLVSSNAQHTCKEDGRLAGMTPVREESTAKKLAGTNSSSLKATAIDQISISACSQAETSYGLGKFET    421 - 490
RPSEFAEKTTNGHKTDPDCKLSDSCGSISKADHSGSLDPTNKGDAREKKPASPQVVKEKESTGTDTSDAK    491 - 560
TLLLNPKSQESGGTESAANPTPSPIRKNQESTLEENRQTKTATSLSLPSDPMGDSSPGSGKKTPSRSVKA    561 - 630
SPRRPSRVSEFLKEQKLNVTAAAAQVGLTPGDKKKQLGADSKLQLKQSKRVRDVVWDEQGMTWEVYGASL    631 - 700
DAESLGIAIQNHLQRQIREHEKLIKTQNSQTRRSISSDTSSNKKLRGRQHSVFQSMLQNFRRPNCCVRPA    701 - 770
PSSVLD                                                                    771 - 776
//

Text Mined References (4)

PMID Year Title