Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
Funding $37,685.34
PubMed Score 2.26
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZVF9 Q8IVE4 GRIN3
Symbols GRIN3

Gene

 Grant Application (2)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22833210 Functional compensation could occur to counteract the loss of one allele in GRIN2C and GRIN3 family genes.

AA Sequence

MGTVPDPLRSAKTSLIAASGKEDDLGEPQAASPRHRPALLCKNANGFSGAPAEPDLSPRAAAEALMQVCE      1 - 70
HETTQPDMSSPGVFNEVQKAPATFNSPGNPQLPGSSQPAASAPSSAAGRDLIHTPLTMPANQHTCQSIPG     71 - 140
DQPNAITSSMPEDSLMRSQRTSNREQPEKPSCPVGGVLSSSKDQVSCEFPSPETIQGTVQTPVTAARVVS    141 - 210
HSSSPVGGPEGERQGAICDSEMRSCKPLTRESGCSENKQPSVTASGPQGTTSVTPQPTPLTSEPSACPPG    211 - 280
PEKVPLPAQRQMSRFKEASTMTNQAESEIKEVPSRAWQDAEVQAVASVESRSVSTSPSILTAFLKESRAP    281 - 350
EHFEQEQLRVICHSSGSHTLELSDSTLAPQESSQCPGIMPQVHIQAAAAESTAFQRENKLASLPGGVLKT    351 - 420
SSINLVSSNAQHTCKEDGRLAGMTPVREESTAKKLAGTNSSSLKATAIDQISISACSQAETSYGLGKFET    421 - 490
RPSEFAEKTTNGHKTDPDCKLSDSCGSISKADHSGSLDPTNKGDAREKKPASPQVVKEKESTGTDTSDAK    491 - 560
TLLLNPKSQESGGTESAANPTPSPIRKNQESTLEENRQTKTATSLSLPSDPMGDSSPGSGKKTPSRSVKA    561 - 630
SPRRPSRVSEFLKEQKLNVTAAAAQVGLTPGDKKKQLGADSKLQLKQSKRVRDVVWDEQGMTWEVYGASL    631 - 700
DAESLGIAIQNHLQRQIREHEKLIKTQNSQTRRSISSDTSSNKKLRGRQHSVFQSMLQNFRRPNCCVRPA    701 - 770
PSSVLD                                                                    771 - 776
//

Text Mined References (4)

PMID Year Title
22833210 2011 Rare mutations in N-methyl-D-aspartate glutamate receptors in autism spectrum disorders and schizophrenia.
15488195 2004 Identification and biochemical analysis of GRIN1 and GRIN2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.