Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 1.2e-04
atypical teratoid/rhabdoid tumor -1.200 8.9e-04
ependymoma -1.400 8.4e-10
glioblastoma -1.100 2.5e-05
group 4 medulloblastoma -1.200 1.8e-02
interstitial cystitis -2.700 3.1e-04
invasive ductal carcinoma 1.100 3.3e-03
pancreatic ductal adenocarcinoma liver m... -2.193 4.5e-03
pediatric high grade glioma -1.100 3.7e-03
psoriasis -1.400 4.1e-12

Synonym

Accession Q6ZVE7
Symbols GOT1
hGOT1b
CGI-141
YMR292W
HMFN1187

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFFQRHKLKGTSF      1 - 70
LLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGALFRRLQGTSSMV             71 - 132
//

Text Mined References (9)

PMID Year Title