Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q6ZVE7
Symbols GOT1
hGOT1b
CGI-141
YMR292W
HMFN1187

Gene

Gene RIF (2)

PMID Text
26255816 GOLT1A knockdown restored tamoxifen resistance and low GOLT1A levels correlate with better survival in patients with breast cancer.
19536175 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFFQRHKLKGTSF      1 - 70
LLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGALFRRLQGTSSMV             71 - 132
//

Text Mined References (9)

PMID Year Title
26255816 2015 miR-378a-3p modulates tamoxifen sensitivity in breast cancer MCF-7 cells through targeting GOLT1A.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10406798 1999 Got1p and Sft2p: membrane proteins involved in traffic to the Golgi complex.