Property Summary

NCBI Gene PubMed Count 39
PubMed Score 18.37
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.509 1.5e-02
active ulcerative colitis -1.401 1.2e-02
adult high grade glioma -1.200 1.5e-05
atypical teratoid / rhabdoid tumor -1.100 1.5e-07
colon cancer -2.300 1.4e-05
ependymoma -1.200 2.1e-02
glioblastoma -1.100 3.4e-02
group 3 medulloblastoma -1.300 1.8e-04
intraductal papillary-mucinous adenoma (... -1.100 2.0e-03
lung cancer 1.100 8.9e-04
malignant mesothelioma 1.700 4.5e-06
medulloblastoma, large-cell -1.400 5.4e-06
osteosarcoma -1.300 5.9e-03
ovarian cancer -2.500 2.1e-20
psoriasis -1.100 4.8e-03
subependymal giant cell astrocytoma -1.966 2.0e-02

Gene RIF (26)

AA Sequence

MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVE      1 - 70
TPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGE     71 - 140
KPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRR    141 - 210
QYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLR    211 - 280
HNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTL    281 - 350
CLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV    351 - 420
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSN    421 - 490
RLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHV    491 - 560
QNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNN    561 - 630
LLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHS    631 - 700
NNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQK    701 - 770
PLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL    771 - 840
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGK    841 - 910
PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELL    911 - 980
ILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLP    981 - 1050
GPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSL   1051 - 1120
HPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSP   1121 - 1190
TLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE   1191 - 1260
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL          1261 - 1323
//

Text Mined References (46)

PMID Year Title