Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.06
PubTator Score 16.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count P-value
ovarian cancer 8492 2.08046460365717E-20
posterior fossa group A ependymoma 1511 3.19082389377714E-14
ulcerative colitis 2087 2.25298776884932E-8
pediatric high grade glioma 2712 3.04138105146917E-8
atypical teratoid / rhabdoid tumor 4369 1.49184640640568E-7
glioblastoma 5572 1.93450534698933E-6
malignant mesothelioma 3163 4.4992820609861E-6
medulloblastoma, large-cell 6234 5.39479352169544E-6
colon cancer 1475 1.44148813598366E-5
group 3 medulloblastoma 2254 1.83287970990058E-4
lung cancer 4473 8.93644208606934E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00202310618479077
psoriasis 6685 0.00484170083662476
osteosarcoma 7933 0.00589368812459784
active Crohn's disease 918 0.0151591992648434
subependymal giant cell astrocytoma 2287 0.0195843406675212

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
posterior fossa group A ependymoma -1.400 0.000
psoriasis -1.100 0.005
osteosarcoma -1.300 0.006
glioblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
group 3 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.002
colon cancer -2.300 0.000
lung cancer 1.100 0.001
active Crohn's disease -1.509 0.015
ulcerative colitis -2.700 0.000
pediatric high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.966 0.020
ovarian cancer -2.500 0.000

Synonym

Accession Q6ZVD8 A1L374 Q9NV17 Q9Y2E3
Symbols PPM3B
PHLPPL

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (20)

PMID Text
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26276160 Suggest that direct PHLPP2 downregulation is required for miR-32-induced cell proliferation of breast cancer cells.
26245343 Results showed that PHLPP1 and PHLPP2 gene expression are down-regulated in esophageal squamous cell carcinoma. Their promotor is a target for mir-224.
25977341 Our studies not only first time identify PHLPP2 downregulation by lung carcinogen B[a]P/B[a]PDE, but also elucidate a novel molecular mechanisms underlying lung inflammation and carcinogenesis upon B[a]P/B[a]PDE exposure.
25888950 miR-135a promotes cell proliferation in bladder cancer by targeting PHLPP2 and FOXO1, and is performed as an onco-
25793736 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma
25160587 Data show that miR-372 modulated the expression of phosphoprotein phosphatase PHLPP2 by directly targeting its 3'-untranslated region (3'-UTR) and that miR-372 expression was inversely correlated with PHLPP2 expression in glioma samples.
24945731 miR-141 and its targets PHLPP1 and PHLPP2 play critical roles in NSCLC tumorigenesis
24892992 biochemical characterization of phosphatase domain of PHLPP1 and PHLPP2;PHLPP1 and PHLPP2 have similar in vitro activities and respond comparably to the presence of metallic ions; metallic ions affect structural stability of the domain;identified 3 residues likely involved in metal coordination and 2 that may be important for structural integrity
24553260 Results reveal PHLPP2 as a new biomarker of cancer progression, and implicate it as major negative regulator of NF-kappaB signaling.
More...

AA Sequence

MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVE      1 - 70
TPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGE     71 - 140
KPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRR    141 - 210
QYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLR    211 - 280
HNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTL    281 - 350
CLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV    351 - 420
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSN    421 - 490
RLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHV    491 - 560
QNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNN    561 - 630
LLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHS    631 - 700
NNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQK    701 - 770
PLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL    771 - 840
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGK    841 - 910
PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELL    911 - 980
ILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLP    981 - 1050
GPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSL   1051 - 1120
HPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSP   1121 - 1190
TLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE   1191 - 1260
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL          1261 - 1323
//

Text Mined References (40)

PMID Year Title
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26276160 2015 MiR-32 contributed to cell proliferation of human breast cancer cells by suppressing of PHLPP2 expression.
26245343 2015 Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma.
25977341 2015 PHLPP2 Downregulation Contributes to Lung Carcinogenesis Following B[a]P/B[a]PDE Exposure.
25888950 2015 Mir-135a enhances cellular proliferation through post-transcriptionally regulating PHLPP2 and FOXO1 in human bladder cancer.
25793736 2015 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25160587 2015 miR-372 regulates glioma cell proliferation and invasion by directly targeting PHLPP2.
24945731 2014 MicroRNA-141 promotes the proliferation of non-small cell lung cancer cells by regulating expression of PHLPP1 and PHLPP2.
24892992 2014 Biochemical characterization of the phosphatase domain of the tumor suppressor PH domain leucine-rich repeat protein phosphatase.
More...