Property Summary

NCBI Gene PubMed Count 33
Grant Count 20
R01 Count 20
Funding $1,212,450.52
PubMed Score 16.06
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
posterior fossa group A ependymoma -1.400 0.000
psoriasis -1.100 0.005
osteosarcoma -1.300 0.006
glioblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
group 3 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.002
colon cancer -2.300 0.000
lung cancer 1.100 0.001
active Crohn's disease -1.509 0.015
ulcerative colitis -2.700 0.000
pediatric high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.966 0.020
ovarian cancer -2.500 0.000

Gene RIF (20)

PMID Text
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26276160 Suggest that direct PHLPP2 downregulation is required for miR-32-induced cell proliferation of breast cancer cells.
26245343 Results showed that PHLPP1 and PHLPP2 gene expression are down-regulated in esophageal squamous cell carcinoma. Their promotor is a target for mir-224.
25977341 Our studies not only first time identify PHLPP2 downregulation by lung carcinogen B[a]P/B[a]PDE, but also elucidate a novel molecular mechanisms underlying lung inflammation and carcinogenesis upon B[a]P/B[a]PDE exposure.
25888950 miR-135a promotes cell proliferation in bladder cancer by targeting PHLPP2 and FOXO1, and is performed as an onco-
25793736 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma
25160587 Data show that miR-372 modulated the expression of phosphoprotein phosphatase PHLPP2 by directly targeting its 3'-untranslated region (3'-UTR) and that miR-372 expression was inversely correlated with PHLPP2 expression in glioma samples.
24945731 miR-141 and its targets PHLPP1 and PHLPP2 play critical roles in NSCLC tumorigenesis
24892992 biochemical characterization of phosphatase domain of PHLPP1 and PHLPP2;PHLPP1 and PHLPP2 have similar in vitro activities and respond comparably to the presence of metallic ions; metallic ions affect structural stability of the domain;identified 3 residues likely involved in metal coordination and 2 that may be important for structural integrity
24553260 Results reveal PHLPP2 as a new biomarker of cancer progression, and implicate it as major negative regulator of NF-kappaB signaling.
More...

AA Sequence

MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSSDLHLVLCTVE      1 - 70
TPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGE     71 - 140
KPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVKRR    141 - 210
QYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLR    211 - 280
HNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTL    281 - 350
CLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV    351 - 420
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSN    421 - 490
RLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPVRILSSLSLRKLMLGHNHV    491 - 560
QNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNN    561 - 630
LLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHS    631 - 700
NNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQK    701 - 770
PLPTTDSTVTSTFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL    771 - 840
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGK    841 - 910
PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELL    911 - 980
ILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLTLP    981 - 1050
GPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSL   1051 - 1120
HPTPTSGLFQRQPSSATFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSP   1121 - 1190
TLCSEEHARGSCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE   1191 - 1260
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL          1261 - 1323
//

Text Mined References (40)

PMID Year Title
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26276160 2015 MiR-32 contributed to cell proliferation of human breast cancer cells by suppressing of PHLPP2 expression.
26245343 2015 Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma.
25977341 2015 PHLPP2 Downregulation Contributes to Lung Carcinogenesis Following B[a]P/B[a]PDE Exposure.
25888950 2015 Mir-135a enhances cellular proliferation through post-transcriptionally regulating PHLPP2 and FOXO1 in human bladder cancer.
25793736 2015 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25160587 2015 miR-372 regulates glioma cell proliferation and invasion by directly targeting PHLPP2.
24945731 2014 MicroRNA-141 promotes the proliferation of non-small cell lung cancer cells by regulating expression of PHLPP1 and PHLPP2.
24892992 2014 Biochemical characterization of the phosphatase domain of the tumor suppressor PH domain leucine-rich repeat protein phosphatase.
More...