Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.32
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.137 7.1e-07
adult high grade glioma -1.700 2.6e-05
Astrocytoma, Pilocytic -1.600 1.0e-07
chronic rhinosinusitis -1.287 2.7e-02
ductal carcinoma in situ -1.300 1.4e-04
glioblastoma -1.400 6.7e-03
group 3 medulloblastoma -2.400 4.4e-04
invasive ductal carcinoma -1.500 4.3e-03
lung carcinoma 2.100 3.7e-08
medulloblastoma, large-cell -2.000 1.7e-04
oligodendroglioma -1.200 1.0e-02
primitive neuroectodermal tumor -1.200 1.5e-02

Gene RIF (15)

AA Sequence

MARPVQLAPGSLALVLCRLEAQKAAGAAEEPGGRAVFRAFRRANARCFWNARLARAASRLAFQGWLRRGV      1 - 70
LLVRAPPACLQVLRDAWRRRALRPPRGFRIRAVGDVFPVQMNPITQSQFVPLGEVLCCAISDMNTAQIVV     71 - 140
TQESLLERLMKHYPGIAIPSEDILYTTLGTLIKERKIYHTGEGYFIVTPQTYFITNTTTQENKRMLPSDE    141 - 210
SRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQ    211 - 280
NGAVSVSAEHHICESTKPLPYTRDKEKGKKFGFSLLWRSLSRKEKPKTEHSSFSAQFPPEEWPVRDEDDL    281 - 350
DNIPRDVEHEIIKRINPILTVDNLIKHTVLMQKYEEQKKYNSQGTSTDMLTIGHKYPSKEGVKKRQGLSA    351 - 420
KPQGQGHSRRDRHKARNQGSEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYK    421 - 490
KRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEKPFQKPRSLDSSRIFDGKAKEPYAEQPNDKME    491 - 560
AESIYINDPTVKPINDDFRGHLFSHPQQSMLQNDGKCCPFMESMLRYEVYGGENEVIPEVLRKSHSHFDK    561 - 630
LGETKQTPHSLPSRGASFSDRTPSACRLVDNTIHQFQNLGLLDYPVGVNPLRQAARQDKDSEELLRKGFV    631 - 700
QDAETTSLENEQLSNDDQALYQNEVEDDDGACSSLYLEEDDISENDDLRQMLPGHSQYSFTGGSQGNHLG    701 - 770
KQKVIERSLTEYNSTMERVESQVLKRNECYKPTGLHATPGESQEPNLSAESCGLNSGAQFGFNYEEEPSV    771 - 840
AKCVQASAPADERIFDYYSARKASFEAEVIQDTIGDTGKKPASWSQSPQNQEMRKHFPQKFQLFNTSHMP    841 - 910
VLAQDVQYEHSHLEGTENHSMAGDSGIDSPRTQSLGSNNSVILDGLKRRQNFLQNVEGTKSSQPLTSNSL    911 - 980
LPLTPVINV                                                                 981 - 989
//

Text Mined References (25)

PMID Year Title