Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.87
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 0.001
ependymoma -1.900 0.001
oligodendroglioma -1.600 0.009
glioblastoma -1.500 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.300 0.008
primitive neuroectodermal tumor -1.400 0.001
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.700 0.000
Pick disease -1.200 0.000
psoriasis 3.400 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPRRRAVILKFSL      1 - 70
QGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPRSPASKLFCHLFVGSQPGEVQILHLLLCR     71 - 140
SFQLAYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSG    141 - 210
KELPESEGRARHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGG    211 - 280
HSCLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVFRNHL    281 - 350
GRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQ    351 - 420
GLG                                                                       421 - 423
//

Text Mined References (5)

PMID Year Title
25331951 2014 Src homology 2 domain containing protein 5 (SH2D5) binds the breakpoint cluster region protein, BCR, and regulates levels of Rac1-GTP.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.