Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.96
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 8.1e-04
astrocytic glioma -1.700 1.1e-03
Astrocytoma, Pilocytic -1.700 5.9e-08
atypical teratoid / rhabdoid tumor -1.300 6.8e-06
ependymoma -1.900 7.4e-04
glioblastoma -1.300 1.7e-07
group 3 medulloblastoma -1.700 1.4e-03
medulloblastoma, large-cell -1.300 7.6e-03
oligodendroglioma -1.600 9.1e-03
Pick disease -1.200 3.3e-04
primitive neuroectodermal tumor -1.400 1.2e-03
psoriasis 3.400 4.9e-57

Gene RIF (1)

AA Sequence

MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPRRRAVILKFSL      1 - 70
QGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPRSPASKLFCHLFVGSQPGEVQILHLLLCR     71 - 140
SFQLAYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSG    141 - 210
KELPESEGRARHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGG    211 - 280
HSCLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVFRNHL    281 - 350
GRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQ    351 - 420
GLG                                                                       421 - 423
//

Text Mined References (5)

PMID Year Title