Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZV80
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MVRMSRPLFLDWAWRPLCSPSQSLPLTYGPEGWILQWKGTCRQQTALHCPFDFPQAPLRGRHTLSQVPNK      1 - 70
GHEKASAVQLPEKQGTDQSRRGPTSAVTKARTSYPESETFIVYLCSYFWNSSKGVYMSGST              71 - 131
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.