Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.25

Knowledge Summary

Patent

No data available

 Compartment GO Term (1)

Protein-protein Interaction (3)

AA Sequence

MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLP      1 - 70
RLRVTRPLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSC     71 - 140
VGTCELANGARGFCPEMGQNESLSEERKGHESKRKSGGRGSPSSHPTQAS                        141 - 190
//

Text Mined References (4)

PMID Year Title