Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 2.0e-06
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.900 2.0e-06

AA Sequence

MADRRRRLRPGTLAPVREGVNCRSRCFTKHKNGLKFPTSLHSRQLVFPRKGLDDFRKGCPPCTGLVTQVP      1 - 70
VEGFLPQIYHRAPQLAPKKRQIKLLKEADVLSKLSPAQQARKAFLEDVEAHLTPHPLALYLNLEEAMPIE     71 - 140
LLSKVLEVLDPDRKLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEEKPHKMDL    141 - 210
LHENGPRPGLHENGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSKLQETEFFQKL    211 - 280
GYERKLQKPQNPYKPKWVKMRYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQEELLADLH    281 - 350
GTVAFKDFILSRGYRTPRFLENMYIGKECKRACNKTPIKRTQA                               351 - 393
//

Text Mined References (8)

PMID Year Title