Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.900 0.000

AA Sequence

MADRRRRLRPGTLAPVREGVNCRSRCFTKHKNGLKFPTSLHSRQLVFPRKGLDDFRKGCPPCTGLVTQVP      1 - 70
VEGFLPQIYHRAPQLAPKKRQIKLLKEADVLSKLSPAQQARKAFLEDVEAHLTPHPLALYLNLEEAMPIE     71 - 140
LLSKVLEVLDPDRKLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEEKPHKMDL    141 - 210
LHENGPRPGLHENGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSKLQETEFFQKL    211 - 280
GYERKLQKPQNPYKPKWVKMRYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQEELLADLH    281 - 350
GTVAFKDFILSRGYRTPRFLENMYIGKECKRACNKTPIKRTQA                               351 - 393
//

Text Mined References (8)

PMID Year Title
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.
9847074 1998 Toward a complete human genome sequence.