Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.041 3.8e-02
astrocytic glioma 2.300 1.2e-03
Breast cancer -1.200 1.5e-02
ependymoma 1.600 5.6e-03
interstitial cystitis 1.300 8.5e-03
medulloblastoma -1.100 3.9e-02
nasopharyngeal carcinoma 1.300 9.8e-04
oligodendroglioma 2.000 1.2e-03
osteosarcoma -1.263 2.4e-07
ovarian cancer -1.900 8.8e-07
subependymal giant cell astrocytoma -2.746 1.6e-02
tuberculosis 1.400 7.1e-05

Synonym

Accession Q6ZV60
Symbols NCRNA00173

 Compartment GO Term (0)

AA Sequence

MSFSPYSTMITVCVCFNSRVQLTVPSFTAWLRSRYSKALFMVLRRAAQEKDKGVCQGWHCVKKWACKGRI      1 - 70
PGQPLQPQPLGPYLRSLSQHPATQTPRPQARASSRYLELHRSQNRGGSEFKFWFCYCLIACCRDSISSSG     71 - 140
KWE                                                                       141 - 143
//

Text Mined References (4)

PMID Year Title