Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 2.300 0.001
ependymoma 1.600 0.006
oligodendroglioma 2.000 0.001
osteosarcoma -1.263 0.000
medulloblastoma -1.100 0.039
adrenocortical carcinoma 1.041 0.038
tuberculosis 1.400 0.000
interstitial cystitis 1.300 0.008
subependymal giant cell astrocytoma -2.746 0.016
nasopharyngeal carcinoma 1.300 0.001
Breast cancer -1.200 0.015
ovarian cancer -1.900 0.000

Synonym

Accession Q6ZV60
Symbols NCRNA00173

Gene

 Compartment GO Term (0)

AA Sequence

MSFSPYSTMITVCVCFNSRVQLTVPSFTAWLRSRYSKALFMVLRRAAQEKDKGVCQGWHCVKKWACKGRI      1 - 70
PGQPLQPQPLGPYLRSLSQHPATQTPRPQARASSRYLELHRSQNRGGSEFKFWFCYCLIACCRDSISSSG     71 - 140
KWE                                                                       141 - 143
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.