Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 480 2.42361066703423E-4

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.295 0.000

Synonym

Accession Q6ZV50 B4DQ32
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid

AA Sequence

MAEGVPASPSSGEGSRGPHSGVIQWLVDNFCICEECSVPRCLMYEIYVETCGQNTENQVNPATFGKLVRL      1 - 70
VFPDLGTRRLGTRGSARYHYDGICIKKSSFFYAQYCYLIGEKRYHSGDAIAFEKSTNYNSIIQQEATCED     71 - 140
HSPMKTDPVGSPLSEFRRCPFLEQEQAKKYSCNMMAFLADEYCNYCRDILRNVEDLLTSFWKSLQQDTVM    141 - 210
LMSLPDVCQLFKCYDVQLYKGIEDVLLHDFLEDVSIQYLKSVQLFSKKFKLWLLNALEGVPALLQISKLK    211 - 280
EVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPE    281 - 350
MKCLRNLISLLGTSTDLRVFLSCLSSHLQAFVFQTSRSKEEFTKLAASFQLRWNLLLTAVSKAMTLCHRD    351 - 420
SFGSWHLFHLLLLEYMIHILQSCLEEEEEEEDMGTVKEMLPDDPTLGQPDQALFHSLNSSLSQACASPSM    421 - 490
EPLGVMPTHMGQGRYPVGVSNMVLRILGFLVDTAMGNKLIQVLLEDETTESAVKLSLPMGQEALITLKDG    491 - 560
QQFVIQISDVPQSSEDIYFRENNANV                                                561 - 586
//

Text Mined References (4)

PMID Year Title
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.