Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.12
PubTator Score 0.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.756 2.5e-08
atypical teratoid / rhabdoid tumor -1.500 9.6e-06
chronic rhinosinusitis -1.322 1.6e-02
diabetes mellitus 1.300 3.8e-03
ependymoma 3.700 2.7e-02
glioblastoma -1.200 3.1e-03
group 4 medulloblastoma -1.300 1.3e-04
nasopharyngeal carcinoma -1.200 9.8e-07
osteosarcoma -1.633 3.2e-06
ovarian cancer -1.100 1.7e-04
pediatric high grade glioma -1.100 4.1e-04
pituitary cancer -1.400 2.9e-03
primitive neuroectodermal tumor -1.400 9.6e-03

AA Sequence

MGTRDDVPEAKVLVPVAVYCGSIPRTSAGPRVLPPGSINSSLPHGEGSLQPEPRALLNNEEPSQLLRGLG      1 - 70
QLGGLKLDTPSKGWQARNGHPRNLRALSLGDQPLVLLPSPESEANSVARDTIQIKDKLKKRRLSEGLAAS     71 - 140
SRASLDPGGGPQGVPLHSTIPRATSQRLLRVPRPMPLIQSIPTTPEASGVKEKGLDLPGSIPGPHELRPG    141 - 210
AQEAQISWQYLHCNDEKMQKSLGAIVIPPIPKARTVAATPSRVPGSLPSPLPPGQGVLTGLRAPRTRLAR    211 - 280
GSGPREKTPASLEPKPLASPIRDRPAAAKKPALPFSQSAPTLTAFSFDCAREACPPLKEEDQKEIGTKIQ    281 - 350
VTISKSAREKMQLKQMKEMELLRRLEEPRTGQELTSQCLGSQRAFMKEGLLPLRGSGTLSVPTRLSGPCR    351 - 420
NDVSIILRKWASRASLPSIPISRQEPRFARHASANSLPAVLTLGSPEWEEEEEMDLRACKELRPFSNPEL    421 - 490
GLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLVVTGEVTNLRSKVSHLAISTLGDLFQ    491 - 560
ALKKNMDQEAEEIARCLLQKMADTNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAE    561 - 630
HLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYDL    631 - 700
QKVMAAIKQQGIEDNDELPSAKGRKVLRSLVVCENGLPIKEGLSCNGPRLVGLRSTLQGRGEMVEQLREL    701 - 770
TRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMIPLLRES    771 - 840
LHPMLLSIIITVADNLNSKNSGIYAAAVAVLDAMVESLDNLCLLPALAGRVRFLSGRAVLDVTDRLAVLV    841 - 910
ASVYPRKPQAVERHVLPILWHFLNTATRNGTLPGPSGNIRGVVCRLSRSLQEHMGSRLLDFAASQPKHVL    911 - 980
KTLQELLDSESLGGSRKATDRGVAPDSKTTGSSYPFQLD                                   981 - 1019
//

Text Mined References (6)

PMID Year Title