Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.24133016981856E-27
periodontitis 269 1.38792957835127E-23
ependymoma 2514 5.40369333144864E-7
medulloblastoma, large-cell 6234 6.21927859734293E-5
ovarian cancer 8492 1.51612651875341E-4
glioblastoma 5572 2.48375709672453E-4
interstitial cystitis 2299 2.56707821114094E-4
atypical teratoid / rhabdoid tumor 4369 3.65681046153596E-4
adult high grade glioma 2148 7.65931996207944E-4
group 4 medulloblastoma 1875 0.00140186753376976
osteosarcoma 7933 0.0206193007687351
invasive ductal carcinoma 2950 0.0207156995026396
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0227159246930795

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 1.063 0.021
ependymoma -1.300 0.000
periodontitis 1.300 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.700 0.000
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.023
interstitial cystitis 1.400 0.000
adult high grade glioma -1.600 0.001
group 4 medulloblastoma 1.100 0.001
lung carcinoma 1.700 0.000
invasive ductal carcinoma -1.100 0.021
ovarian cancer -1.900 0.000

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

AA Sequence

MSGSCAAPGPGSGSSPAACRFAHYFVLCGIDADSGLEPDELAGENFDQSPLRRTFKSKVLAHYPQNIEWN      1 - 70
PFDQDAVNMLCMPKGLSFRTQTDNKDPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTAMQTLYQMHN     71 - 140
AEHYSSVYASSSCSMDSLASSLDEGDTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFMQACKKFLIQ    141 - 210
LYKAVTSQQPPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPSELPLSDYPLREAFELLGL    211 - 280
ENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQS    281 - 350
KEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDFIQELSEVLVQFGIPPEGSLHCSESTSKL    351 - 420
KNMVLKDLVNDKKNGNVCTNNISMYELLKGNETIARLQALAKRTGVAVEKMDLSASLGEKDKDLKLHCEE    421 - 490
AELRDYQLNVQLREVFANRFTQMFADYEAFVIQTAQDMESWLTNREQMQNFDKASFLSDQPEPYLPFLSR    491 - 560
FIETQMFATFIDNKIMSQWEEKDPLLRVFDTRIDKIRLYNVRAPTLRTSIYQKCSTLKEAAQSIEQRLMK    561 - 630
MDHTAIHPHLLDMKIGQGKYEQGFFPKLQSDVLATGPTSNNRWVSRSATAQRRKERLRQHSEHVGLDNDL    631 - 700
REKYMQEARSLGKNLRQPKLSDLSPAVIAQTNCKFVEGLLKECRMKTKRMLVEKMGHEAVELGHGEANIT    701 - 770
GLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLIQFQDREEKQEHLAESPVALGPERRKSDSGVMLP    771 - 840
TLRVSLIQDMRHIQNMSEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRYAFLRCEEERE    841 - 910
QFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAIITSNPWICVSGELGDTGVMQIPKNLLEM    911 - 980
TFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGIDDGSLERILIGELMTS    981 - 1050
ASDEDLVKQCRTPPQQKSPTTARRLSITSLTGKNNKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSLTVL   1051 - 1120
LCGENGLVAALEQVFHHGFKSARIFHKNVFIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVN   1121 - 1190
AINTAPRNIGKDGKFQILVCLGTRDRLLPQWIPLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDF   1191 - 1260
TIVLEGSLIKGVDV                                                           1261 - 1274
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...